SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154149907|ref|YP_001403525.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154149907|ref|YP_001403525.1|
Domain Number 1 Region: 170-361
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.81e-17
Family Terpene synthases 0.066
Further Details:      
 
Domain Number 2 Region: 375-559
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000000593
Family Protein prenyltransferases 0.027
Further Details:      
 
Weak hits

Sequence:  gi|154149907|ref|YP_001403525.1|
Domain Number - Region: 50-183
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0018
Family Complement components 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154149907|ref|YP_001403525.1|
Sequence length 601
Comment hypothetical protein Mboo_0362 [Methanoregula boonei 6A8]
Sequence
MSIKRDIGILLIITCLVGICAFFIINTTTPTSYESWNEKTVEKIGYSRAPEGGYADFAPD
DPDLYSTYYFSLALKNEHIGLMQKEQTEQWLYSREQDFLRNTSEVSLKDLYYLTGCMKNY
DIPPENQSGIISLVEQFGKSDGSYADRPGFNGSSLDTARALKILEFTGNNVVTANITREW
LMQQWKSDQISTDEDYLLAETEILVPAFHLANIDPNEFEIDSSQKSVEEQHALIWKSRLG
DLPEKKIDLFTLNALETELRTSGGLTPDISRKVQDYVYSLELPDGGYNAILNNYGDAQGT
YLATKLLSDIGSPVNNRTINFIKRHESRYGGFHPAFKITPSPKDTWFAIRALTLLDPRNP
TVSEIKPWLDTQLSSPHLSPENQYYVVMTYGELGESVPNAASIRSTLEQQITTISGSASG
PGDMEQIFYLLNMAKVVDLSLDSVQKDRLIRKINEIQNADGCYGRERSDLVTTYYALGSL
DALLATPSNPDACAAWIEQGYTRDGGYRYRGENWSTNFSYISPTWLSISSLDYLHKYPKT
AGNTLQWINSSRYPNGGIQLMPKQPETEVNDATFRESLEYTVQGLETERILLHNGGFSRG
Y
Download sequence
Identical sequences A7I571
456442.Mboo_0362 gi|154149907|ref|YP_001403525.1| WP_011991370.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]