SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154150073|ref|YP_001403691.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150073|ref|YP_001403691.1|
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 1.7e-111
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150073|ref|YP_001403691.1|
Sequence length 279
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanoregula boonei 6A8]
Sequence
MVVKVGVAKLGNIASGVMAELLLDERADREDMQTFMATSGTKLQPEDIDRVVSNMKAWKP
DFAIVVSPNGVLPGPTGAREQLAAAGIPVIIITDDVTTKKEWEEVKNSKFGYIIMKADSM
IGARREFLDPIEMADFNGNLVKVLAITGAFRKLQLALDKVIDQVKAGKKGTEIELPKIVM
TTDKAVDGEFTNDYALAKARAAHEIAIAVAGQNVKGCFMTKEWEKYIPIVASAHEMMRIA
AVLCDEAREIEKAGDGILRQPHKKDGVLVRKTKLVAKFE
Download sequence
Identical sequences A7I5N7
456442.Mboo_0530 WP_012106069.1.2930 gi|154150073|ref|YP_001403691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]