SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154150125|ref|YP_001403743.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150125|ref|YP_001403743.1|
Domain Number 1 Region: 7-279
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.1e-143
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 280-560
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.14e-139
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150125|ref|YP_001403743.1|
Sequence length 561
Comment coenzyme-B sulfoethylthiotransferase [Methanoregula boonei 6A8]
Sequence
MAKAKIERTQKLFLKAMKEKFAEDPQATSTVFARAGLEQSPRKMEFLKEGQKVALDRGIS
MYDPKRCHCGGIPLGQRQLMTYEVSGTGVFVEGDDLHFVNNAAMQQMWDDIRRTIIVSLD
LAHGTLQKRLGKEVTPETINEYLHVLNHAMPGAAVVQEHMVETHPALVDDCYVKIFTGDD
EMADDIEPQFVLNLDKLFPAKQAAALKAAVGKSMWQAVHIPTTVSRTCDGGTTSRWSAMQ
IGMSFIGAYKMCAGEAAVSDLAFAAKHAGVIQMADILPARRARGPNEPGGIKFGHFGDMI
QADRKYPNDPVKATLEVVGAGAMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDDYCYYG
LDYVKKNHGGLGKAKLTQEAVSDIASEVTLYGMEQYEQYPTALEDHFGGSQRASVLAAAS
GISASLGTFNSNAGLNAWYQSMLLHKEGWSRLGFFGYDLQDQCGSANCMSVRPDEGCLGE
LRGPNYPNYAMNVGHQGEYAAIASAAHYGRQDAWVLSPLMKITFADPSLKFDFSEPRREF
ARGAIREFMPAGERSLIIPAR
Download sequence
Identical sequences A7I5T9
456442.Mboo_0582 gi|154150125|ref|YP_001403743.1| WP_012106121.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]