SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154150129|ref|YP_001403747.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150129|ref|YP_001403747.1|
Domain Number 1 Region: 189-437
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.14e-113
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000274
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 6.67e-78
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150129|ref|YP_001403747.1|
Sequence length 437
Comment methyl-coenzyme M reductase subunit beta [Methanoregula boonei 6A8]
Sequence
MAKYKDTIDLYDDEGKLLKSNVTIDKISPLTNKGALELIDLTKRTVAVNLGGIEEALKTG
KMGGKSNQILGRGLNYSIVKDADAISAKIKDMIQVTDGDNTKITKIGGGKMLLVEVPSSR
INASATYDATSTSVASATTYALIDQYKVNMFDGSYVKGAVWGTYPQTMDMQGGNVVSILS
IPQNNEGLGYALRNIPANHAVMMTHRNAMQGAALSATFEQAGEFEMGAAIGPFERAQLLL
YAYQGLNANNIVYDLVKKNGKTGTIGTVVQSLVERAIEDKVIKAGKKGKSGYIFYDTKDP
MLWNAYASAGTLAATMVNCGAGRFAQAVSATLLYFNDLLEHETGLPGSDFGRAMGVAVGF
SFFSHSIYGGGGPGGFNGNHVVTRHAAGVGMPCIVAACALDAGTQMFGPEATSKVYQDTF
GQIDAFKRPIQTIAKGV
Download sequence
Identical sequences A7I5U3
456442.Mboo_0586 gi|154150129|ref|YP_001403747.1| WP_012106125.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]