SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154150388|ref|YP_001404006.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150388|ref|YP_001404006.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Vng1086c-like 5.1e-30
Family Vng1086c-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150388|ref|YP_001404006.1|
Sequence length 93
Comment hypothetical protein Mboo_0845 [Methanoregula boonei 6A8]
Sequence
MHKEELISLHKILYEVKDYFEEANPDLKFSQYGALKITPSQLHKSKLEHKYAIFVLGNEI
ANAMKEVDYSSSSRISARMKDLAEKTLKEMEYA
Download sequence
Identical sequences A7I6K2
456442.Mboo_0845 WP_012106387.1.2930 gi|154150388|ref|YP_001404006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]