SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154150569|ref|YP_001404187.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150569|ref|YP_001404187.1|
Domain Number 1 Region: 186-259
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000165
Family Transglutaminase, two C-terminal domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150569|ref|YP_001404187.1|
Sequence length 422
Comment hypothetical protein Mboo_1026 [Methanoregula boonei 6A8]
Sequence
MIQTIHPRATPDNGKLSPTERPAGQMQERVRQKKFPGSVSGIFLLLAVTLGIFAIPVSAY
PTPYSLSADSSVYVSNVTYYPGAFFSGDSGTVTYQVINGNTNTSMVVNHASFSDTDIRLT
SGTYDSSQNIGPLQTEPFTFSITTNASDGNYYPTFSLSFQDGESMHYQGLVKVDNRPLVM
TIQDQPDAYTQGKKNTISVQIANPRSDDVHNVIFTVSGDGATLTPSQTYIGDLPSGAMTL
VNFTVTPNAPTTLNLVVGYDNGDNAHSIDSTLPIQFTTDKQQADPVMSNIVITANGTVYT
VNGDSTNAGLLNANGVTITALSPAVPEDPYQNYVIGTLKPDDFGSFELTFSVPEGTKSIP
LKQSFKDSDGNVITSTQDIDLTTAQQASQSNAGPGMLPVLVVVAIVVIGAGGYLYMKKNR
KQ
Download sequence
Identical sequences A7I733
WP_012106571.1.2930 gi|154150569|ref|YP_001404187.1| 456442.Mboo_1026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]