SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154151035|ref|YP_001404653.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151035|ref|YP_001404653.1|
Domain Number 1 Region: 163-273
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.26e-17
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151035|ref|YP_001404653.1|
Sequence length 282
Comment anti-sigma-factor antagonist [Methanoregula boonei 6A8]
Sequence
MVKQKSKLIDIFTNNEQEILEDWMREQIASITYRKDLLTEAELRTQSAELMGLMIAASRS
GNVTDMTTPEWKPVLDFLAATSKTRAAQGFTTQETATFIFSLKQPVFARMKSELGTNASA
LAEEIWIATVLLDKLGLFTAETYQKSREDIIRRQQRELLELSTPVIKIWEGILVLPLIGT
LDDSRTQVVMENLLQNIVDTNSSIAIIDITGVPEVDTLVAQNLIKTVSAARLMGAHCIIS
GIRPQIAQTMVHLGVAFGDVVTKSSLADALKYAFQQAGITVT
Download sequence
Identical sequences A7I8E9
gi|154151035|ref|YP_001404653.1| 456442.Mboo_1492 WP_012107049.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]