SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154151190|ref|YP_001404808.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154151190|ref|YP_001404808.1|
Domain Number - Region: 176-240
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00152
Family Transglutaminase, two C-terminal domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151190|ref|YP_001404808.1|
Sequence length 455
Comment hypothetical protein Mboo_1648 [Methanoregula boonei 6A8]
Sequence
MKFHAACIGILLVFLMVAAASAGSTSSTTSTGSTTSSTSSVSASTTVSAEQALSQVYVSS
VTVDPQVFYPGDQGTITVQLTNSGTQEVAFEHADILNSQNVYIPDELHNPYQVMTYLGPG
NTMTYTFNVVAKGSEGIYYPDFSVASRDSASIIYPIKVQVDSTPVQETITLRPDNFALDN
TDTVNLTITNPRNGAIDNVEVTPSGTGFGISPLQSFIVSIPGDSSVNIPFAITPYQAGSN
VTFTIQYSNGQTIQNPHTDTVVLPLNIGPSKTAATTVINDLALTVSNGAYQLTGDVTNTG
ITDANGVVVTAGAPAQPVEPYSSYAVGSLTSNDFSSFTLTFTASDLSAIPITTQWKDANG
NTLSSTQTFDLRSLASAAESGTRSGSYSGGSSTGVSSSASGYGGAARGGGLFGIGGGRGG
GLSSFYPVIIGAIVIIAAIALYVKRKWILGKFRKQ
Download sequence
Identical sequences A7I8V4
456442.Mboo_1648 gi|154151190|ref|YP_001404808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]