SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117927239|ref|YP_871790.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927239|ref|YP_871790.1|
Domain Number 1 Region: 19-270
Classification Level Classification E-value
Superfamily Cgl1923-like 1.31e-80
Family Cgl1923-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117927239|ref|YP_871790.1|
Sequence length 310
Comment hypothetical protein Acel_0028 [Acidothermus cellulolyticus 11B]
Sequence
MLDPTDLYTISGTPPARAPDAPLILVHALSGYVDAGDAVRLTARHLLDTLDHREIARFDI
DQLFDYRARRPPMLFDEDHWAAYDAPELVVHAVTDGGGREFLLLTGPEPDTQWERFVAAV
CTLLERYGVDVTVGLNAIPLATPHTRPIGVTRHATSQDLIPGNRPWLQQVHVPASAAHLL
EFRLGEQGRKAMGIAVHVPHYVAQSEFPPAALRLIDELRERTGLDLPREPIATAAAATLA
EIDRQVGESTDAMAMVSTLEQQYDAFLHARSGESPLGGGTDNLPSADELAAELERFLAEQ
ARRHRDDRDQ
Download sequence
Identical sequences A0LQU4
gi|117927239|ref|YP_871790.1| WP_011718868.1.7777 351607.Acel_0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]