SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117927301|ref|YP_871852.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927301|ref|YP_871852.1|
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily PhoU-like 9.73e-54
Family PhoU-like 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117927301|ref|YP_871852.1|
Sequence length 220
Comment phosphate uptake regulator PhoU [Acidothermus cellulolyticus 11B]
Sequence
MRDAYHEELDALRVDMVDLARRVRTAMSRASRALLEGDLAVAEEVIDGDDDVDQMRRDIE
RRIVDLIARQQPVASDLRVLTAGLRIVADLERAGDHAVHLAKLARRRYPMTVVPEPLRPV
IARMGEAAVGIAGELEEVLATADAARAASMERHDDTMDALHRALLREMLETPWSYGVDTA
IDLAYASRYFERYADHLVSAARHVNYQVTGQWTAEVGDLA
Download sequence
Identical sequences A0LR06
351607.Acel_0090 WP_011718930.1.7777 gi|117927301|ref|YP_871852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]