SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117927826|ref|YP_872377.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927826|ref|YP_872377.1|
Domain Number 1 Region: 52-459
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.55e-79
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000522
Further Details:      
 
Domain Number 2 Region: 870-1019
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.14e-46
Family Cellulose-binding domain family III 0.0000192
Further Details:      
 
Domain Number 3 Region: 472-782
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.97e-42
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000581
Further Details:      
 
Domain Number 4 Region: 1200-1295
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.39e-29
Family Cellulose-binding domain family II 0.0003
Further Details:      
 
Domain Number 5 Region: 1046-1134
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-16
Family Fibronectin type III 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117927826|ref|YP_872377.1|
Sequence length 1298
Comment cellulose-binding family II protein [Acidothermus cellulolyticus 11B]
Sequence
MDRSENIRLTMRSRRLVSLLAATASFAVAAALGVLPIAITASPAHAATTQPYTWSNVAIG
GGGFVDGIVFNEGAPGILYVRTDIGGMYRWDAANGRWIPLLDWVGWNNWGYNGVVSIAAD
PINTNKVWAAVGMYTNSWDPNDGAILRSSDQGATWQITPLPFKLGGNMPGRGMGERLAVD
PNNDNILYFGAPSGKGLWRSTDSGATWSQMTNFPDVGTYIANPTDTTGYQSDIQGVVWVA
FDKSSSSLGQASKTIFVGVADPNNPVFWSRDGGATWQAVPGAPTGFIPHKGVFDPVNHVL
YIATSNTGGPYDGSSGDVWKFSVTSGTWTRISPVPSTDTANDYFGYSGLTIDRQHPNTIM
VATQISWWPDTIIFRSTDGGATWTRIWDWTSYPNRSLRYVLDISAEPWLTFGVQPNPPVP
SPKLGWMDEAMAIDPFNSDRMLYGTGATLYATNDLTKWDSGGQIHIAPMVKGLEETAVND
LISPPSGAPLISALGDLGGFTHADVTAVPSTIFTSPVFTTGTSVDYAELNPSIIVRAGSF
DPSSQPNDRHVAFSTDGGKNWFQGSEPGGVTTGGTVAASADGSRFVWAPGDPGQPVVYAV
GFGNSWAASQGVPANAQIRSDRVNPKTFYALSNGTFYRSTDGGVTFQPVAAGLPSSGAVG
VMFHAVPGKEGDLWLAASSGLYHSTNGGSSWSAITGVSSAVNVGFGKSAPGSSYPAVFVV
GTIGGVTGAYRSDDGGTTWVRINDDQHQYGNWGQAITGDPRIYGRVYIGTNGRGIVYGDI
AGAPSGSPSPSVSPSASPSLSPSPSPSSSPSPSPSPSSSPSSSPSPSPSPSPSPSRSPSP
SASPSPSSSPSPSSSPSSSPSPTPSSSPVSGGVKVQYKNNDSAPGDNQIKPGLQVVNTGS
SSVDLSTVTVRYWFTRDGGSSTLVYNCDWAAIGCGNIRASFGSVNPATPTADTYLQLSFT
GGTLAAGGSTGEIQNRVNKSDWSNFTETNDYSYGTNTVFQDWSKVTVYVNGRLVWGTEPS
GTSPSPTPSPSPTPSPSPSPSPGGDVTPPSVPTGVVVTGVSGSSVSLAWNASTDNVGVAH
YNVYRNGVLVGQPTVTSFTDTGLAAGTAYTYTVAAVDAAGNTSAPSTPVTATTTSPSPSP
SPTPSPTPSPTPSPSPSPSLSPSPSPSPSPSPSPSLSPSPSTSPSPSPSPTPSPSSSGVG
CRATYVVNSDWGSGFTATVTVTNTGSRATSGWTVAWSFGGNQTVTNYWNTLLTQSGASVT
ATNLSYNNVIQPGQSTTFGFNATYAGTNTPPTPTCTTN
Download sequence
Identical sequences A0LSI1
gi|117927826|ref|YP_872377.1| 351607.Acel_0618 WP_011719454.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]