SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117928276|ref|YP_872827.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928276|ref|YP_872827.1|
Domain Number 1 Region: 17-266
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.36e-79
Family Histidine biosynthesis enzymes 0.000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117928276|ref|YP_872827.1|
Sequence length 285
Comment Imidazole glycerol phosphate synthase cyclase subunit [Acidothermus cellulolyticus 11B]
Sequence
MTATAPDGAQRLDAGVAIRVIPCLDVDAGRVVKGVNFVHLRDAGDPVELAAAYNAEGADE
LVFLDITASSGDRETMYDVVRRTAEQVFIPLTVGGGVRSVADFDRLLRAGADKVGVNTAA
IADPRLLAEGADRFGAQCVVLSIDARRRPDMPSGFEVTTHGGRRSAELDAVEWAIRAVDL
GAGEILLNSMDADGTQAGFDLELIRAVRSAVNVPIIASGGAGRAADFPPAIAAGANAVLA
ASVFHFGLLRIADVKDALRQAGYPVRDATSALRDPGPARHDPGPA
Download sequence
Identical sequences A0LTT1
WP_011719904.1.7777 gi|117928276|ref|YP_872827.1| 351607.Acel_1069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]