SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117928362|ref|YP_872913.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928362|ref|YP_872913.1|
Domain Number 1 Region: 80-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000144
Family NfeD domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117928362|ref|YP_872913.1|
Sequence length 143
Comment hypothetical protein Acel_1155 [Acidothermus cellulolyticus 11B]
Sequence
MPMWLIWTIVAVACAGAEALTLTLILGFIAAAAALTLVAAVLGAPIVAQLLVFVGSAAAL
LGVVRPIARAHLYTPPALRTGVDALVGQRGLVVERVDAHHGQIKIGGELWSARPYVDGQC
YEPGTTVEVVKIQGAIALVFGTE
Download sequence
Identical sequences A0LU17
gi|117928362|ref|YP_872913.1| WP_011719990.1.7777 351607.Acel_1155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]