SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117929217|ref|YP_873768.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117929217|ref|YP_873768.1|
Domain Number 1 Region: 147-403
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 7.85e-25
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0065
Further Details:      
 
Domain Number 2 Region: 60-178
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000314
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117929217|ref|YP_873768.1|
Sequence length 404
Comment hypothetical protein Acel_2010 [Acidothermus cellulolyticus 11B]
Sequence
MRGHLSWMGCAAAALVLVTACAAPNGQSPRAAGSAPGLAASKARNGSASPAGGASRGGAV
GAAAVRQLRLRGQIGVRLAGETLAVTHDGGRTWAPVSLPAGLAPANIAAVDSAPDGAPLL
AAVDPTGSVHVYRYAAEWSAVRLDPRWPAGTSTADGTEQVAFHPAAGGIVAVVVSLAGGG
FSAEHALFVSTDNGGHFGPPATPNGPDVNVRWSGLLMVTPRIGVLVAGPTQELLLRTTDG
GASWQRLSVPGVGGPGTFALGAPVLSGSRIDIPVTVQAAADGSREKFFLLASDDQGATFT
VRGVALDIPADFAPTGAVTGNTGSTWWVVAPSIGTVYETTDDGASWRTVHETGLALNTVA
VTLTGPAAATAVIAVNSCANDKSECTMTVTVEQTTDGGATWSPA
Download sequence
Identical sequences A0LWH2
351607.Acel_2010 gi|117929217|ref|YP_873768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]