SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117929249|ref|YP_873800.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117929249|ref|YP_873800.1|
Domain Number 1 Region: 8-370
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.97e-68
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117929249|ref|YP_873800.1|
Sequence length 373
Comment hypothetical protein Acel_2042 [Acidothermus cellulolyticus 11B]
Sequence
MAEVAVRVLIGTRKGAFIATSDDTRRSWSVTGPLFAGWEVYHVQASPVDPDRLYAAPSRG
WFGQTIQRSDDGGRSWQLVGNDFRYDGEIGDHFWYDGTLRPWHFTRVWHLAPSPVDANTV
YAGTEDAALFVSSDGGQTWPELTGLRCHDTAPNWAPGAGGLCLHTILFDPRDATRMHVAI
SAAGVLRSDDAGLTWRTANRGLRSDFLPQPEADVGHCVHKIARHPARPDVLFMQKHWDVM
RSDDGGNSWYEISGDLPSDFGFPIAVHPHDPDTVYVVPITSDTEHFPPEGRLRIYRSRTG
GRYWEPLSKGLPQEHCYVNVLRDAFATDELEPCGLYVGTTGGQIYASADEGATWTTIGRD
LPAVLSVEVQTLR
Download sequence
Identical sequences A0LWK4
351607.Acel_2042 gi|117929249|ref|YP_873800.1| WP_011720877.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]