SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111019124|ref|YP_702096.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111019124|ref|YP_702096.1|
Domain Number 1 Region: 77-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.39e-18
Family GntR ligand-binding domain-like 0.0096
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.73e-16
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111019124|ref|YP_702096.1|
Sequence length 232
Comment GntR family transcriptional regulator [Rhodococcus jostii RHA1]
Sequence
MARREPAGSLSDHVYLSLRTDLMSGRIPPGQRLGEERLADTYGVSRTPVREALARLLADG
LVQRDVGGLFPYRPRIDELAGLYELRITLELQGIARVRADESLSHDPDVLGPELDRWYAL
RKENPEPDAGFVALDEQFHTVLLRSAGNRALSDALVNVNAKVRPVRMFDYLTPDRMSATV
DEHISVAELALDGKLDSAYDTLLAHISESREVVIERAEQALSLARMAWAIRD
Download sequence
Identical sequences Q0SEU8
gi|111019124|ref|YP_702096.1| 101510.RHA1_ro02131 WP_011594949.1.53434 WP_011594949.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]