SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111023355|ref|YP_706327.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111023355|ref|YP_706327.1|
Domain Number 1 Region: 77-206
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 7.85e-21
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.34e-18
Family GntR-like transcriptional regulators 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111023355|ref|YP_706327.1|
Sequence length 214
Comment GntR family transcriptional regulator [Rhodococcus jostii RHA1]
Sequence
MTHTERALLTESVHDTLREQIFSGELPPGTPLSVPALAAKLNVSRTPVREAVQQLIYEGI
AVYTRNAGAKVDSLDADSIRAVFEVREVLDGLAAFHATAAATHETVQQLKKMVQVQRELL
DGPADQRRDSRLDLEFHTLIRETARNKPLSEALLRLDGQSHLYRSDMWSADLNRRLAVTE
HERIVGAIESGDAVGARAAACAHVAGLLIRTTRM
Download sequence
Identical sequences J1QSM7 Q0S2R7
101510.RHA1_ro06393 WP_009479591.1.53434 WP_009479591.1.60566 WP_009479591.1.78234 gi|111023355|ref|YP_706327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]