SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153932404|ref|YP_001383189.1| from Clostridium botulinum A str. ATCC 19397

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153932404|ref|YP_001383189.1|
Domain Number 1 Region: 1-112,140-509
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.97e-169
Family Clostridium neurotoxins, catalytic domain 0.00014
Further Details:      
 
Domain Number 2 Region: 498-830
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.44e-119
Family Clostridium neurotoxins, "coiled-coil" domain 0.00056
Further Details:      
 
Domain Number 3 Region: 841-1022
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.92e-37
Family Clostridium neurotoxins, the second last domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153932404|ref|YP_001383189.1|
Sequence length 1193
Comment botulinum neurotoxin type A1 nontoxic-nonhemagglutinin subunit [Clostridium botulinum A str. ATCC 19397]
Sequence
MNINDNLSINSPVDNKNVVVVRARKTDTVFKAFKVAPNIWVAPERYYGESLSIDEEYKVD
GGIYDSNFLSQDSEKDKFLQAIITLLKRINSTNAGEKLLSLISTAIPFPYGYIGGGYYAP
NMITFGSAPKSNKKLNSLISSTIPFPYAGYRETNYLSSEDNKSFYASNIVIFGPGANIVE
NNTVFYKKEDAENGMGTMTEIWFQPFLTYKYDEFYIDPAIELIKCLIKSLYFLYGIKPSD
DLVIPYRLRSELENIEYSQLNIVDLLVSGGIDPKFINTDPYWFTDNYFSNAKKVFEDHRN
IYETEIEGNNAIGNDIKLRLKQKFRININDIWELNLNYFSKEFSIMMPDRFNNALKHFYR
KQYYKIDYPENYSINGFVNGQINAQLSLSDRNQDIINKPEEIINLLNGNNVSLMRSNIYG
DGLKSTVDDFYSNYKIPYNRAYEYHFNNSNDSSLDNVNIGVIDNIPEIIDVNPYKENCDK
FSPVQKITSTREINTNIPWPINYLQAQNTNNEKFSLSSDFVEVVSSKDKSLVYSFLSNVM
FYLDSIKDNSPIDTDKKYYLWLREIFRNYSFDITATQEINTNCGINKVVTWFGKALNILN
TSDSFVEEFQNLGAISLINKKENLSMPIIESYEIPNDMLGLPLNDLNEKLFNIYSKNTAY
FKKIYYNFLDQWWTQYYSQYFDLICMAKRSVLAQETLIKRIIQKKLSYLIGNSNISSDNL
ALMNLTTTNTLRDISNESQIAMNNVDSFLNNAAICVFESNIYPKFISFMEQCINNINIKT
KEFIQKCTNINEDEKLQLINQNVFNSLDFEFLNIQNMKSLFSSETALLIKEETWPYELVL
YAFKEPGNNVIGDASGKNTSIEYSKDIGLVYGINSDALYLNGSNQSISFSNDFFENGLTN
SFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYFQDTGLVFNMIDSNGNEKNIYLSDVSN
NSWHYITISVDRLKEQLLIFIDDNLVANESIKEILNIYSSNIISLLSENNPSYIEGLTIL
NKPTTSQEVLSNYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLT
INNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDISEDNRLQLIDNKNN
AKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNNDMSKYLYLWSFK
Download sequence
Identical sequences A5HZZ8 Q45914
WP_011948510.1.10598 WP_011948510.1.25111 WP_011948510.1.27088 WP_011948510.1.28409 WP_011948510.1.34822 WP_011948510.1.46754 WP_011948510.1.5655 WP_011948510.1.63111 WP_011948510.1.63218 WP_011948510.1.65258 WP_011948510.1.75721 WP_011948510.1.92266 YP_001253341.1.75347 YP_001386737.1.17653 gi|148378800|ref|YP_001253341.1| 413999.CBO0805 441770.CLB_0847 441771.CLC_0861 gi|153932404|ref|YP_001383189.1| gi|153935962|ref|YP_001386737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]