SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124022652|ref|YP_001016959.1| from Prochlorococcus marinus str. MIT 9303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124022652|ref|YP_001016959.1|
Domain Number 1 Region: 211-366
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-42
Family Histidine kinase 0.00071
Further Details:      
 
Domain Number 2 Region: 4-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-29
Family KaiB-like 0.0025
Further Details:      
 
Domain Number 3 Region: 131-196
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000334
Family Homodimeric domain of signal transducing histidine kinase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124022652|ref|YP_001016959.1|
Sequence length 370
Comment adaptive-response sensory kinase [Prochlorococcus marinus str. MIT 9303]
Sequence
MDGVKANQRQQLQLLLVAARHQLSRSDLRSMIQFLENEDCGFDVTLQMADPSEQPELLEL
HRLVATPALIKLSPTPKQVFAGSSIFQQLQNWITRWQQDIVVTGLGLSLRPTELDGSRTQ
RELQLEDQLLVLRQENETLIDRLNAQERTLRMVAHELRTPLTAAVLALQSQQLGQINIEH
FQDVVKRRLDEIELLSKDLLEVKSTRWEDLFNPQNLDLGNIAAEAILELEKLWLDRNIEI
HTDIPSDLPKVFADQRRMRQVLLNLLENALKFTEDGGQVSLSMLHRTSQWVQVSICDNGP
GIPEDEQERIFLDRVRLPQTSVTTSGFGVGLSVCRRIVEVHGGKIWVVSEPDKGACFYLT
VPVWQRNGQE
Download sequence
Identical sequences A2C884
gi|124022652|ref|YP_001016959.1| 59922.P9303_09431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]