SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114562018|ref|YP_749531.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114562018|ref|YP_749531.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.92e-43
Family SMI1/KNR4-like 0.00000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114562018|ref|YP_749531.1|
Sequence length 133
Comment hypothetical protein Sfri_0840 [Shewanella frigidimarina NCIMB 400]
Sequence
MNDIIEQLQELSETVPVPLELPTFEQLVEVEEQILIGLPNDLKEFLLYGSDVIYGTLEPV
TAADPSSHTYLPEVACYAWSIGLPREQIAICQIGDSFYCIDEESQVLFWKKGRFSDKVWE
SFWHWAEDVWLNR
Download sequence
Identical sequences A0A119CZE4 A0A2I0H9J6 Q086X2
NYSGXRC-10412c WP_011636316.1.15765 WP_011636316.1.45693 gi|114562018|ref|YP_749531.1| 318167.Sfri_0840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]