SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114561597|ref|YP_749110.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114561597|ref|YP_749110.1|
Domain Number 1 Region: 22-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-39
Family DsbA-like 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114561597|ref|YP_749110.1|
Sequence length 205
Comment DSBA oxidoreductase [Shewanella frigidimarina NCIMB 400]
Sequence
MKKALLMAAALLLAPMAAMAADYKEGVHYTVINDGPETAKPEITEFFSFYCPHCFNFSKT
VVPKIEANLPEGVAFNQSHVEFIGRDMGVEMSRAFAVAQQLNVEKKMDAALFTAIHDKRQ
QFTRPDDIRAIFIANGVDGKAYDAAASSFMVNAQMSKMKRDTENAKISGVPTLVVNGKYR
VETSSIKSYDELIDIAFYLTSMNKK
Download sequence
Identical sequences Q088P3
gi|114561597|ref|YP_749110.1| 318167.Sfri_0410 WP_011635899.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]