SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114561708|ref|YP_749221.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114561708|ref|YP_749221.1|
Domain Number 1 Region: 6-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 1e-57
Family Glutathione peroxidase-like 0.000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114561708|ref|YP_749221.1|
Sequence length 189
Comment alkyl hydroperoxide reductase [Shewanella frigidimarina NCIMB 400]
Sequence
MTQSIINSTIKPFKATAFHNGAFVEVTEQDLLGKWAVVFFYPADFTFVCPTELGDMADHY
EKLQAMGVEVYSVSTDTHFTHKAWHSSSDTIGKITYPMIGDPTGAITRNFGVMIEEDGLA
LRGTFVINPEGQVKVAEIHDLGIGRSASELVRKIQAAQYVATHDGEVCPAKWQPGEETLA
PSIDLVGKI
Download sequence
Identical sequences A0A119CYS0 A0A2I0H760 Q088D2
gi|114561708|ref|YP_749221.1| 318167.Sfri_0522 WP_011636010.1.15765 WP_011636010.1.45693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]