SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114562016|ref|YP_749529.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114562016|ref|YP_749529.1|
Domain Number 1 Region: 11-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-29
Family Glutathione S-transferase (GST), N-terminal domain 0.00098
Further Details:      
 
Domain Number 2 Region: 95-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114562016|ref|YP_749529.1|
Sequence length 227
Comment glutathione S-transferase domain-containing protein [Shewanella frigidimarina NCIMB 400]
Sequence
MAFFIVRIDWITPKGFNMITLYGTQKSRALRVSWLLEELGVEWQFHFIDFAKGENKRDAF
LALNPSGKMPVLTDGDFVLTESAAIMRYLAEKYGQGKWLPKPGTQASGIHERWMSFVISE
LEQPLWSMGKHRFALPKELRVDAMFAVAKWEFDQAAAIAETWIPESGFVCGSSPMVADIL
LAQTLGWALGFEQHLPPKLSAYRDRLKQRPALAAALAKTAPLVNATK
Download sequence
Identical sequences Q086X4
gi|114562016|ref|YP_749529.1| 318167.Sfri_0838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]