SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114562901|ref|YP_750414.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114562901|ref|YP_750414.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-18
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114562901|ref|YP_750414.1|
Sequence length 76
Comment thiol-disulfide isomerase and thioredoxins [Shewanella frigidimarina NCIMB 400]
Sequence
MKIIKVLGSGCKKCLETAELAQAIADEKGVAIKIEKVTDMAQIMAYDVMSTPAVVVDEKV
VHKGSKPTKDQMAMWI
Download sequence
Identical sequences Q083I9
gi|114562901|ref|YP_750414.1| 318167.Sfri_1726 WP_011637192.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]