SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114562923|ref|YP_750436.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114562923|ref|YP_750436.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-32
Family Thioltransferase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114562923|ref|YP_750436.1|
Sequence length 113
Comment glutaredoxin-like protein [Shewanella frigidimarina NCIMB 400]
Sequence
METVEKIKQQISENPIIVYMKGSPKLPSCGFSSQVAQVMINCGEQFAFVDILQHPDIRAE
LPKFANWPTFPQLWVEGELIGGCDIITEMFQKGELQPIIKATADKFRTEDAAE
Download sequence
Identical sequences A0A106C1D2 A0A2I0H7J3 Q083G7
318167.Sfri_1748 gi|114562923|ref|YP_750436.1| WP_011637214.1.15765 WP_011637214.1.45693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]