SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114563035|ref|YP_750548.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114563035|ref|YP_750548.1|
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.03e-41
Family Glutathione peroxidase-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114563035|ref|YP_750548.1|
Sequence length 155
Comment thioredoxin-dependent thiol peroxidase [Shewanella frigidimarina NCIMB 400]
Sequence
MNTLNVGDTAPNFTLQNQAGEAVSLQDTLSKGPVLVYFYPKASTPGCTVQAQGLRDIKAQ
LDGLHVTVFGISPDPVAKLAKFADKQQLNFALLSDEDHAVADGFGVWGQKKFMGKIYDGI
HRLSFIVGTDGKISHVLNKFKTKDHHEVVLATLAE
Download sequence
Identical sequences A0A106BZ89 A0A2I0H9I8 Q082V5
318167.Sfri_1862 gi|114563035|ref|YP_750548.1| WP_011637326.1.15765 WP_011637326.1.45693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]