SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114563669|ref|YP_751182.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114563669|ref|YP_751182.1|
Domain Number 1 Region: 87-206
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 5-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.16e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114563669|ref|YP_751182.1|
Sequence length 218
Comment glutathione S-transferase domain-containing protein [Shewanella frigidimarina NCIMB 400]
Sequence
MVLPVLYSLRNCPYAMRARLAIYASNQQINLRDLVLSNKPVEMLTVSPKGTVPVLVTADN
EVIDESLSIMLWAFSQTDPDDYISQATPNALAEMLAVIAIFDNEFKGHLEKYRCSKRYHE
PSLVEDRQQCERYLADLESRLCQHSYLMSDQPSLTDLALMPFIRQFARVERQWYLQSPYP
KLRQWLNHYLQSRMFSKVMVQNPMWLDSKQEVVFGANV
Download sequence
Identical sequences Q080H1
318167.Sfri_2500 WP_011637953.1.15765 gi|114563669|ref|YP_751182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]