SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114564465|ref|YP_751979.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114564465|ref|YP_751979.1|
Domain Number 1 Region: 82-206
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.7e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 11-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.61e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114564465|ref|YP_751979.1|
Sequence length 209
Comment stringent starvation protein A [Shewanella frigidimarina NCIMB 400]
Sequence
MAVAANKRSIMTLFSGADDLYSHQVRIVLAEKGVTVDVLQVDPSEMPEDLLEVNPYNSVP
TLVDRELVLYESRIIMEYLDERFPHPPLMPVYPVSRGQSRLMMHRIDTDWYALVERIRKG
EKADAARKELMESLIALAPVFAEMPYFMSEEFGLSDCYLGPLLWRLPVLGIHLDPRTSKD
ISAYMTRIFERESFKASLTEAEREMRMGM
Download sequence
Identical sequences A0A125BEU7 A0A2H0F5F9 A0A2I0HAY7 Q07XX4
WP_011638743.1.15765 WP_011638743.1.45693 318167.Sfri_3304 gi|114564465|ref|YP_751979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]