SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126700413|ref|YP_001089310.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126700413|ref|YP_001089310.1|
Domain Number 1 Region: 630-727
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000357
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 2 Region: 774-894
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000119
Family Galactose-binding domain 0.058
Further Details:      
 
Domain Number 3 Region: 179-231
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000144
Family Type I dockerin domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1666-1793
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000248
Family Galactose-binding domain 0.053
Further Details:      
 
Weak hits

Sequence:  gi|126700413|ref|YP_001089310.1|
Domain Number - Region: 517-590
Classification Level Classification E-value
Superfamily Fibronectin type III 0.012
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126700413|ref|YP_001089310.1|
Sequence length 1987
Comment calcium-binding adhesion protein [Clostridium difficile 630]
Sequence
MKKAISCVLAVSMCSAPLNVFAEPILEGKLRAVEKSVTEKLRGSLEVDLNFSLPIKNSES
ESMTNMQLRLKDDSNNSGIIKLGEKDSGTVNVGTDNIEYTIKKLSASRSEIKNKDENVSY
YNIVFNNLPVGKYNVEVSGAGFKNKEIKDIDISSYSQRVLLSNRASVDNKNKPLNYELFL
MGDVNGDGKVDKSDYNKVLENIDSNKREFDLNRDGKVDIVDLDYVQKNLGQSEDAKSLES
IVSTNPIVDTSKVELKGNSDVDINGNVENLFSGENNGVTISSKNDEISEEKPAVMDIALS
EALNMEVINIKAPEGTAPAKGIVEVTDKDGNIQQIPYENKEYMKNLKDEEQQEEVNNEQE
EVNQEEVNNKDENINQTDNNSNNKDENNDKQQENSDKQEANSNTNQDKNNDKENSSMDKP
NSDEDTPKEGDNISKDDNFTTSTYSRSALETYADVQNSDIVINLGKQVAVKKITIKITAT
TANDRNLAEISKVEFLNNVYKEIPKPEMNIPKINKILTSTAVGNEKVSFYWNNEVNVSAY
ELILDKIDSKGKVLSTKKLQTSKNTIEVRDIEAYGLYRVSIQSLNGDWSSGYKDATPENL
DGVPENVDSNYKPIQFSPDSILEFQVVPDTKPEPPEGINVKGKFKSLDVSWKNHKQAKDF
DLYYKEKGSNGSWIKYNDKLIRGTSSKIEGLKDNTTYEVRMTATNHLGTSGMSKTYIGTT
ESMDAPTTPNYRLINTPKENGGFGIPTNHIVDVTYPAGYDKSEYSDKNPFDKFNVVDGDF
TTHWTFPTYNAAEGTNRGPIITFDKSYTMDTFMATPRFDVSDKTINDFEVRYWDENGQLH
NLGDVPFETKTDPVNNNKYVMVRLKEPITATKIQVSVCSSYSYKSNISELKFYEYDSIED
DVRNLFMDDLQVELKEDVTQEKITELKDRLNTPDKASGEYHPYKTVIERELKLAQDLYND
RATLTDVTTVNQEINKLGKYKDKNGQYTVNSNNLGMQNDWQALGVAARAGDEITVYVGSK
SGKTPKLIYTQYYGESGAYKSGEINLNTGKNVIQLSKLHSLDIECGGSLYIRYAEDTPSG
GDIKVRVAGATKIPHLNLNGTINDKSPAGVSESKKKIKAYIEELARYKDAVKGEPYYPGT
NVGNSYGYSEKTGVLNTTDIESDKVTLNVPATAVYQGISKGNADLNTQVDRLYNSMLAWE
QIMDLVYSERGVFKTQDLDGNGTVDDNEFNLTKNDMAPKSRMNIKYQRMFIGAFMYASGL
HVGVEYGSVPGLMNGVPFQIDDSGKATGGNLFGWGIGHEIGHVTDIGKMTYSETSNNVLA
LLAQTFDDKTHSRLEGSTMDKIYEHVTSNSLGIPSNVFERLGMLWQLHLAYDDDFTGSML
KNNSDADLSNDTFYAKISRKYRALSSSDPINSLPKDQMLVAMASSVVEKDLRDYFKAWGV
EITPELNSIMDSKNYEKESRKIQYVNDEARRKILNENIASMAKDTKVSASFSDGIQSGSL
VKSNKISIDLDVDKDKDKILGYEIIRSDGNYLDGENGTQVKYRTVGFVDAKGNSKTKFTD
NISPLNNRAFTYKVVAYDYHLNPTEEFEVGTVKLSDEGKINKSAWSFITNTVSDGDVRTE
NDSHGPLQNPEIDNIKDNDASTTYKGKIISKAEWNKDPQKDPDINVEENPYIIVDMKETL
PIVGLKYTKPEAEARKFSLKGLFNFRKNTSTTYNPLTNYKIQVSNDKKNWEDVSQGTFEY
GQDLVGGGKDQDNEARVTFNKDGKLWTYQARYVKLISNNKSNIEVAELDIIGPPGDNIEI
GTMNNADQTRTNGIGKLAEDYVYQSDDSSTSEDETGKIPAGSIVITGEYSGNPAFNLPLL
IDKNNKTISGEALLFAEVPEKGELGEISKGTWVYYMPKENFDSLSDKVKAELYRYNDLQG
DTPVGQRFVSDTMYVPVGAKNYDELKTISLTDSNSKARKATRNAIDISNKKVITVSNKVK
GNIVRDK
Download sequence
Identical sequences A0A2J9P9C0 Q183N3
272563.CD2797 gi|126700413|ref|YP_001089310.1| WP_011861690.1.32294 WP_011861690.1.37597 WP_011861690.1.4137 WP_011861690.1.5905 WP_011861690.1.75638 WP_011861690.1.81044 WP_011861690.1.85127 WP_011861690.1.94166 YP_001089310.1.32744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]