SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121596309|ref|YP_988205.1| from Acidovorax sp. JS42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121596309|ref|YP_988205.1|
Domain Number 1 Region: 69-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.02e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.86e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121596309|ref|YP_988205.1|
Sequence length 204
Comment glutathione S-transferase domain-containing protein [Acidovorax sp. JS42]
Sequence
MKLIGSNTSPYVRKVRVVLAEKKLDYQFVEENVWADDTAISASNPLGKVPCLIMEGGEAV
FDSRVIVEYLDTLSPVGKLIPALGRERAEVKTWEALADGLLDAAILARLEATWAGRQDGE
RSQAWIDRQLAKARASLQSMSKGLGDKPYCSGIHLTLSDIAVGSALGWLEFRFPDIAWRT
DHPNLARLMDKLMQRQSFIDTQPR
Download sequence
Identical sequences A1WD04
232721.Ajs_4025 gi|121596309|ref|YP_988205.1| WP_011807108.1.39107 WP_011807108.1.80021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]