SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222476008|ref|YP_002564529.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222476008|ref|YP_002564529.1|
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000421
Family PIN domain 0.012
Further Details:      
 
Domain Number 2 Region: 89-193
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000093
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222476008|ref|YP_002564529.1|
Sequence length 265
Comment hypothetical protein Hlac_3104 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MTRYFVDTNVLIGLTFSHDRWAVEAERILDGHNTLFTSDFVIYEYCSRPQGAPRVVSDPD
QLQVDPDGTGGVFGTVLEDFQENVEDNIPMYNREIDLQRYDGLSFERILEIFFDNIEVRS
QAKPHFVRHFQNYFSSREITPRNAKRCVEDLRDRVLHDAKERKDALMDAVHIMSSTYDDQ
ERARGLVQEHIGIRESRIPPVDSQWLLDAIGLAERDMLQRVVTGDKKDIVRYQQQLASLF
DVSILYILDEFHSHSQAGQGSREVF
Download sequence
Identical sequences B9LVD0 G2MQK0
gi|222476008|ref|YP_002564529.1| WP_014053518.1.44229 WP_014053518.1.75361 WP_014053518.1.80915 gi|345007412|ref|YP_004810264.1| 416348.Hlac_3104 gi|345007412|ref|YP_004810264.1|NC_015955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]