SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222478443|ref|YP_002564680.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222478443|ref|YP_002564680.1|
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.21e-35
Family YigZ N-terminal domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 147-208
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000074
Family YigZ C-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222478443|ref|YP_002564680.1|
Sequence length 210
Comment hypothetical protein Hlac_0004 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSETYLTVGESATARFEVQGSEFFGHVAPADTVAAAEEFIDRVRTEYDDATHNVPAYRVP
AGEASARTPGSEVMLREYSSDDGEPTGSAGKPALNVLQQRDIRNVVAVVTRYYGGTNLGV
GGLARAYSRAVKDGVDEAGVIEERPHRQLVVETAYDDSGTVRGVIESSGVEFDADYDERV
RLVLRVPVAEVESLVERLNSATSGRVEIDR
Download sequence
Identical sequences B9LQ76
WP_012659257.1.44229 WP_012659257.1.66911 WP_012659257.1.80915 416348.Hlac_0004 gi|222478443|ref|YP_002564680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]