SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222480006|ref|YP_002566243.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480006|ref|YP_002566243.1|
Domain Number 1 Region: 4-27
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000785
Family HIT zinc finger 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222480006|ref|YP_002566243.1|
Sequence length 47
Comment hypothetical protein Hlac_1587 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSVTGLCHVCEAAPASHTCPRCGRAVCEDHWDDDADICTACAQGQTQ
Download sequence
Identical sequences B9LP85
gi|222480006|ref|YP_002566243.1| 416348.Hlac_1587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]