SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222480749|ref|YP_002566986.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|222480749|ref|YP_002566986.1|
Domain Number - Region: 36-57
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000942
Family MYND zinc finger 0.067
Further Details:      
 
Domain Number - Region: 9-39
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0046
Family TFIIH p44 subunit cysteine-rich domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222480749|ref|YP_002566986.1|
Sequence length 59
Comment hypothetical protein Hlac_2340 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSESETQGTRQCVSCGIQVAGMNAARFSCPDCGETIHRCAKCRKQSNLYECPDCGFRGP
Download sequence
Identical sequences A0A0F8AUU1 A0A2A2F4P0 A0A2G1WL92 B9LSG9 M0E1T7 M0NLB9 M0PA48
gi|222480749|ref|YP_002566986.1| WP_004047107.1.26896 WP_004047107.1.44229 WP_004047107.1.59655 WP_004047107.1.61020 WP_004047107.1.6107 WP_004047107.1.66911 WP_004047107.1.80915 WP_004047107.1.81988 416348.Hlac_2340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]