SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222480837|ref|YP_002567074.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480837|ref|YP_002567074.1|
Domain Number 1 Region: 43-114
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.58e-19
Family Ribosomal S5 protein, N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 128-207
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-17
Family Translational machinery components 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222480837|ref|YP_002567074.1|
Sequence length 215
Comment 30S ribosomal protein S5P [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSRHNDGWEPRTRLGRKVQNGDISSMEQALDSGLPLKEAEIVDQLLPGLEDEVLDINMVQ
RMTDSGRRVKFRCVVAVGNRDGYLGYAQARDDQVGGAIQKAIDVAKLNIIEVDRGSGSWE
DQPGGTNSLTRKAEGKAGSVTVEIQPAPQGLGLAAAETVRNILELAGVEDAWTNSDGNTR
TTVNLAKATFNALENAAQSRTPQHAREVHYDEVSE
Download sequence
Identical sequences B9LSQ7 M0DZW1
416348.Hlac_2429 gi|222480837|ref|YP_002567074.1| WP_004047210.1.44229 WP_004047210.1.59655 WP_004047210.1.66911 WP_004047210.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]