SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222481105|ref|YP_002567342.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222481105|ref|YP_002567342.1|
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.66e-33
Family Imidazole glycerol phosphate dehydratase 0.00022
Further Details:      
 
Domain Number 2 Region: 91-183
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-29
Family Imidazole glycerol phosphate dehydratase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222481105|ref|YP_002567342.1|
Sequence length 198
Comment imidazoleglycerol-phosphate dehydratase [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSDHERAAAVSRETSETTIDLTLAIDGDGDSEVDTGIGFFDHMLSSFAKHGLFDLTVNCD
GDTEIDDHHTVEDVAICLGEAFDEALGDKRGIRRYADRRVPLDEAVASVVVDVAGRPYYE
FSGEFSQESVGEFTSVMADHFALSLAHNAGLTLHAAIETGDNAHHEVEALFKALARALDD
ATRLDGRRSDTPSTKGEL
Download sequence
Identical sequences B9LU78
416348.Hlac_2701 WP_015911382.1.44229 WP_015911382.1.66911 WP_015911382.1.80915 gi|222481105|ref|YP_002567342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]