SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257062796|ref|YP_003142468.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257062796|ref|YP_003142468.1|
Domain Number 1 Region: 48-245
Classification Level Classification E-value
Superfamily Sortase 2.62e-40
Family Sortase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257062796|ref|YP_003142468.1|
Sequence length 307
Comment SrtB family sortase [Slackia heliotrinireducens DSM 20476]
Sequence
MNWSLPRRLVRGTIRLANWLVDGAVLAAVVMIVCFTAFAVLDNNRVADEADVQMFEQYRP
EADNTVSFEELQAQNPDVLGWLTVYGTGIDYPLVQGKDNDVYINTNAAGEFALSGSLFLD
WHNAPDFTDASTIIYGHHMENSLMFGDLDKYGDAEYMAQHCYGNLFYEGADHGVELLGYL
QVDAYDNVVYSVTVGESPTVEEFLDYTRDHATVWRADPDEGDRLLVLSTCGSGTNDRHVV
IARICDQTFEDAFAEEEPDRVERLLSGTAEGLKLGAQIGVGLAVFLLTAWVVGGTGRRGK
RKKNGKE
Download sequence
Identical sequences C7N0P1
WP_012797230.1.33174 gi|257062796|ref|YP_003142468.1| 471855.Shel_00440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]