SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257062798|ref|YP_003142470.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257062798|ref|YP_003142470.1|
Domain Number 1 Region: 48-406
Classification Level Classification E-value
Superfamily Multiheme cytochromes 5.08e-40
Family Di-heme elbow motif 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257062798|ref|YP_003142470.1|
Sequence length 442
Comment hypothetical protein Shel_00460 [Slackia heliotrinireducens DSM 20476]
Sequence
MKASKKTTAAIVVGLVAVLALSMFAIGCKGGNEATVTHSDDTAATADESTMRGYAEQFPL
EYNSSQMTRVNAKGFTIGHDVGTLRDICERPVMRDVNGDIEWNEDGTMSVFTSEYDEESG
QYIVPDLTDEQLEELNLKSGCVACKSSKFNDIYAAQGPAAYGNVYNGEARAIVNDEYWDC
AMCHDGTPSADNVGPQLVYFQALGEGLVEQLDPKMAVCAQCHNSYDYRSRIQTEEDLATF
KPYRYGNDIDAVFQSAYEDEVNFFENDLGLPESYVVHPNVEGYMSTKHNAMGVTCVDCHM
PVTVDEETGTEYRSHFSANSPLESEDSLNYCLTCHKSQGIESTEAMVDFVRGKQEVLAGD
IETLKADIDAYGTALSEAIASGSMSDADVEQAKMDYAKATWYYQTLVTGPYESLGSQIAM
LDTADILTKAHAAIDEGTGLIG
Download sequence
Identical sequences C7N0P3
gi|257062798|ref|YP_003142470.1| 471855.Shel_00460 WP_012797232.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]