SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257062932|ref|YP_003142604.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257062932|ref|YP_003142604.1|
Domain Number - Region: 15-95
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000753
Family Di-heme elbow motif 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257062932|ref|YP_003142604.1|
Sequence length 143
Comment C_GCAxxG_C_C family redox protein [Slackia heliotrinireducens DSM 20476]
Sequence
MDIDVERRVAHALELHERGFNCAQCVACATCDLAGLDEKAAFRLAEGFGGGMGGFTETCG
AISGGIMVMGYRMSKGPDGPITKKSTYVRAKQLVEDFRKKNGSTLCGVIRGETGGPKLRT
CDGCIEDGVRLALAQMVDIDATA
Download sequence
Identical sequences C7N1G3
gi|257062932|ref|YP_003142604.1| 471855.Shel_01840 WP_012797366.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]