SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257063165|ref|YP_003142837.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257063165|ref|YP_003142837.1|
Domain Number 1 Region: 80-174
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000193
Family Di-heme elbow motif 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257063165|ref|YP_003142837.1|
Sequence length 182
Comment hypothetical protein Shel_04270 [Slackia heliotrinireducens DSM 20476]
Sequence
MKRIQRASHTTSKNKLTLVAGTIGALLVALAIGCSPSGTNATSSDGDATDSATFDTASYQ
LHVENCDGGAGLASFHTALGYDCTSCHGSDLPDQLSGIETEDGSEPELTSTYFVDNDKCF
ACHGTWEDLATATESLGDYNPHDSIHGTVQYCNECHKGHSEQVDICGECHPNGGQTMRGT
VS
Download sequence
Identical sequences C7N2W7
471855.Shel_04270 gi|257063165|ref|YP_003142837.1| WP_012797594.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]