SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257063493|ref|YP_003143165.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257063493|ref|YP_003143165.1|
Domain Number 1 Region: 50-113
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000773
Family Cytochrome c3-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257063493|ref|YP_003143165.1|
Sequence length 137
Comment hypothetical protein Shel_07600 [Slackia heliotrinireducens DSM 20476]
Sequence
MKKRAFIIAMCMTLALSFGAVAGCSSSDDGAASNPDAVAGTETTPRLMPAQHQKYIDRPA
YKCYKCHGASEKGNPTVSTSRAMPAGHYVDNDPSSFQLDPSREECRTCHSVDPNKQMNAD
VLEDAEVETGQQDLDEQ
Download sequence
Identical sequences C7N4I1
WP_012797920.1.33174 gi|257063493|ref|YP_003143165.1| 471855.Shel_07600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]