SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257064338|ref|YP_003144010.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257064338|ref|YP_003144010.1|
Domain Number 1 Region: 181-319
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000472
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.066
Further Details:      
 
Weak hits

Sequence:  gi|257064338|ref|YP_003144010.1|
Domain Number - Region: 5-64
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0044
Family Di-heme elbow motif 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257064338|ref|YP_003144010.1|
Sequence length 322
Comment F5/8 type C domain-containing protein [Slackia heliotrinireducens DSM 20476]
Sequence
MSQQFCTSCGAPVQEGRNFCTSCGAPVASANTQTEVRKPSTQQRICPNCHAAVADGMPFC
TSCGHYLDAPVAAPPTQPTAKGPNKTLVAAVAAAVIIVAAVAATLAIIQPWAHDEPDAKS
EPAVAHKADKDDAETEDASDATADSDGAADATADSEEEPQADPANTDAAKEEALDASVPA
VFDHVRASSELPPDEYNSYYGVNNAVDNDMATAWNEGNESNNGEGEWIEIYADTEQVCTQ
VRFVPGYPKSELVYNNNCRPKNVTVSFSDGTSIDVEIEDIMGQEITLDLDKPVKTTFVRL
TINEVFPGDQWTDCTVAEFHAS
Download sequence
Identical sequences C7N6X6
471855.Shel_16420 gi|257064338|ref|YP_003144010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]