SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257064375|ref|YP_003144047.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257064375|ref|YP_003144047.1|
Domain Number 1 Region: 244-395
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 4.97e-21
Family Oxidoreductase molybdopterin-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 81-170
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000000404
Family Di-heme elbow motif 0.017
Further Details:      
 
Domain Number 3 Region: 418-502
Classification Level Classification E-value
Superfamily E set domains 0.00000000091
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|257064375|ref|YP_003144047.1|
Domain Number - Region: 59-111
Classification Level Classification E-value
Superfamily NE1680-like 0.0379
Family NE1680-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257064375|ref|YP_003144047.1|
Sequence length 529
Comment sulfite oxidase-like oxidoreductase [Slackia heliotrinireducens DSM 20476]
Sequence
MSRKKKLFALGATALLAGALCAVGCAQTEAENPDDASSVVIENPAVFVDDDGDLIQLAPF
DDRTNAAWYQQDPFKQFNTNYLHADQRGCKSCHSDLADLVWNSEYYHPGRYGLNVEWTVQ
TCRGCHSTSGYGIDITEDNKFGDIMHATHMNVETECWSCHATSSSNLIYDSDTEGTMLLW
EDARTEELRGFTDIASDDMDGEFTYNQDLVMDVEDLPSIDVQFYEWDYKRIENEANDVPL
DAQMMKDWTITMSGKVKEEKTWNLQDLIDDPNVPKETKVVKWHCVLNAFGGNVIGQAEVT
GIPYSWLIEQCGGLTEDANGIENFSADGFSDGASVPLELVTDGTALVVYEVNGEPLTWSV
GYPCFGMAGGTACGSWAKQLSDIVVTGPETPFFNMVTGRPASADENDTLQYNNPNVGIIG
LKDGQVVQAGEPLTIQGYADAFDKEITAVELSFDRGATWKTFPVSGTDLEKLLIWEYTFT
PDAGSYYVEARAVNSDGKTSSLNFSRMFTAVEDIDSVSAVPAADAEEEE
Download sequence
Identical sequences C7N713
WP_012798800.1.33174 gi|257064375|ref|YP_003144047.1| 471855.Shel_16790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]