SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257064937|ref|YP_003144609.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257064937|ref|YP_003144609.1|
Domain Number - Region: 139-164
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000907
Family DNA primase zinc finger 0.062
Further Details:      
 
Domain Number - Region: 100-160
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0151
Family Di-heme elbow motif 0.055
Further Details:      
 
Domain Number - Region: 27-105
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0497
Family Outer membrane efflux proteins (OEP) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257064937|ref|YP_003144609.1|
Sequence length 166
Comment hypothetical protein Shel_22500 [Slackia heliotrinireducens DSM 20476]
Sequence
MGFLDNVTASVNRGVASAGRTTETLKLKNQLNDINKQRQALAAQLGASLYEATRENVDFR
SGREGLYEGIASLDAQREAVNAQIMQLEAQERQQQINARVYTCPGCGGRVAETDMFCATC
GTPIAQVRAANAMPSPMPGQVPCPHCGSPMNQGDAFCMHCGTAVSH
Download sequence
Identical sequences C7N138
WP_012799360.1.33174 471855.Shel_22500 gi|257064937|ref|YP_003144609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]