SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257064996|ref|YP_003144668.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257064996|ref|YP_003144668.1|
Domain Number 1 Region: 258-401
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 5.76e-30
Family Oxidoreductase molybdopterin-binding domain 0.00084
Further Details:      
 
Domain Number 2 Region: 430-508
Classification Level Classification E-value
Superfamily E set domains 0.00000000119
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.062
Further Details:      
 
Domain Number 3 Region: 65-169
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000275
Family Di-heme elbow motif 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257064996|ref|YP_003144668.1|
Sequence length 521
Comment sulfite oxidase-like oxidoreductase [Slackia heliotrinireducens DSM 20476]
Sequence
MLKKEGNAPRRRKIGVLFAIVAAAVCLLAVAACGTPQTAEPSETNAAAGIDYKEAGFSVF
TESDTGMYPDTAWNKNFLNAGNRGCNSCHESLTSVIEGAGLPADHPVPKVGYANDRNVTI
LDGCLSCHDVHSADYGNYFADAIHNAHYSNVGFTEELGGNCWSCHAINDAPGITEIGNTD
WVLWEQVMYEGALGGFPDASDYPLTREFLRLNGHDSGYVTDVAATEQPEINVEMSQDLSD
LEDAFVALNHPTYGPDFLYDPTHTFTVSGVNEPREFSLEDLQAMPQTTQRATLQCAVAGS
AGHNIYNAEYEGVMLSDIIEACGGLEEGVTGVRVTGWDDWECANIAWPISNYDNAMVALK
INGEDMPYEYGGPMVVIVPGAPGGPNCKFIKTIDFTNEEAMDLVGALYQNVPGDVLPAVS
AAWFQNDGLEYKLGDTVELTGYAYALATSVAPLDKIEFSTDLGATWTTFDVPEDYDPYQW
VTFNFSWTPDTAGTHIIKVRGVNDDGYLSNIDGSIIVTVTE
Download sequence
Identical sequences C7N197
471855.Shel_23090 WP_012799419.1.33174 gi|257064996|ref|YP_003144668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]