SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257065116|ref|YP_003144788.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257065116|ref|YP_003144788.1|
Domain Number 1 Region: 88-224
Classification Level Classification E-value
Superfamily Sortase 3.14e-40
Family Sortase 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257065116|ref|YP_003144788.1|
Sequence length 344
Comment sortase, LPXTG-site transpeptidase [Slackia heliotrinireducens DSM 20476]
Sequence
MAILIVTAGVLLFSYPVLASAVNDYFAFREVSEYTADVEAMDQSELDRQIALAQAYNQDL
PLSFPADPFSGNNLQDFEGTEFEDFELVQPGAMIGYLEIPDIHVYQSMYYGTSEEVLSKG
LGLVENTSLPVGGPGTHAVISGHTGMASRALFTDLDKLEIGQVFFVHVLNQHFAYEVDQI
VVVLPHETEELMIQKDQDLVTLVTCTPFGINDHRLLVRGHRIDWDFSVQEKGLGSLAGPN
WTLWISILSVGAIIILLMIAKVWRDRRKDAAAKAEVDSAADPEALEASAKTDDSQEQNPQ
EAAAASEEPPNEEVLEETADSEQSEELEATEGGETDDCDHDQDA
Download sequence
Identical sequences C7N1Z8
471855.Shel_24310 WP_012799538.1.33174 gi|257065116|ref|YP_003144788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]