SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389321|ref|YP_003110885.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389321|ref|YP_003110885.1|
Domain Number 1 Region: 20-277,386-432
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-66
Family Protein kinases, catalytic subunit 0.0000366
Further Details:      
 
Weak hits

Sequence:  gi|256389321|ref|YP_003110885.1|
Domain Number - Region: 482-552
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000291
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256389321|ref|YP_003110885.1|
Sequence length 571
Comment serine/threonine protein kinase [Catenulispora acidiphila DSM 44928]
Sequence
MTLDMNSDVHKGGSPATDRLGPYLLVTQLGSGAMGRVFLGTDSTGRQAAVKVVRSDLADI
PAFRKRFSRELNVAERVHSPRVAEIYDAQTEGKRPWLATEYVPGPTLQDAVEQGGAFDNE
HLRALAVAIAEALEVIHAAEVVHRDLKPANVLLGPDGPKVIDFGVARALDASLLTNTGQT
LGTPAYMSPEQADGRAVESASDVFALGSLLVFAATGRLAFGDGAPLAILHRVVNNDPDLS
GVAEDDEVLRGVIEGCLCKEPEDRPSPQQIKDTFGAIGWQPLTGVAWQQPPLGVGLPLTA
GDAADLPTVAIAPKRGTKRVAVISAATVAALILATIAVVEASGGGKGNTAADTARTGGPT
SSSQQNGGAFPSTDTSSGSTSSSGQTTPTSSSPPPPSQASGAPVPPGGGAGSTAPPQGSS
QLVTVSVPITQGNGGSSQKPAPTSSHPTTHPSSAHTTSAAPPPPPTHNPPGPMVAGDISV
LIPNWVGAATVNVSWKAHSDATSYAIHYTVKGTATNSDQTVPVSGTSYSYQIPADGTTCL
QVRTVNQYGSSAFYPSPMYCVNSFGQVSSGG
Download sequence
Identical sequences C7QHA5
479433.Caci_0089 gi|256389321|ref|YP_003110885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]