SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389603|ref|YP_003111167.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389603|ref|YP_003111167.1|
Domain Number 1 Region: 417-555
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-24
Family APC10-like 0.037
Further Details:      
 
Domain Number 2 Region: 658-794
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-23
Family Galactose-binding domain 0.097
Further Details:      
 
Domain Number 3 Region: 565-654
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-18
Family Fibronectin type III 0.0000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256389603|ref|YP_003111167.1|
Sequence length 795
Comment coagulation factor 5/8 type domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MTVTRRRFLTTAAAGSAAALLAGPDLLAAPAARAASPAGDVVGKITVGYQGWFACAGDGA
PIGGWWHWAQNWAQTPSPSNNVIKAWPDMREYTHAYQTAYSNLGNGQPATLFSSYDQQTV
DTHFLWMQQNGCDTAALQRFNPNSSEGPTRDAMATKVRSSAETHSRKFYIMYDVTGWTAM
QAEIKADWTSKMSALTASSAYAHQNGKPVVGIWGFGFNDANHPWDAATCLDVITWFKSQG
CYVMGGVPREWRTGTGGSRAGYLGVYHAFDMLSPWMVGAIGTAADSDNAYTNLTVPDLAD
CTANNVDYQPCVLPGDLSGRQRVHGDFMWRQFYNMARAGTQSVYISMFDEYGEGNQIAKT
AENQSMSPNGAGLLALDEDGTACSSDYYLRLTADGGRMLKGQIPLTATRPTQPVAGSGGG
SGNLALGKPASASGTSQNFGPGNAVDGDPNTYWESVNNAFPQWFQVDLGSVAAVGSVVMK
LPASWGARTQTLALAGSSDGSTFSTLAASAGRTFDPATGNTVTINVGTASVRYLRATFTA
NTGWPAGQLSEFQVFAPTSGGGGDTTPPTAPTNLAVTGHTSSSVSLSWTASTDNIGVTGY
QVRVNGTTALTVTKTTATVTGLSPSTAYSFAVVATDALGNVSLPSATVSATTDPATNANL
ALGKPTSESGHTQSYASSNTVDGDANTYWESVDNAFPQWLMVDLGAVTSVSRVVLKLPPA
TAWAARTQTVAVTGGADASAASTLSASAGRLFDPATGNSVTITFPATSVRYVRLTFTANT
GWPAGQISEFQVYAS
Download sequence
Identical sequences C7PVH0
WP_012784621.1.73754 479433.Caci_0373 gi|256389603|ref|YP_003111167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]