SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389646|ref|YP_003111210.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389646|ref|YP_003111210.1|
Domain Number 1 Region: 64-386
Classification Level Classification E-value
Superfamily Subtilisin-like 7.46e-40
Family Serine-carboxyl proteinase, SCP 0.00035
Further Details:      
 
Domain Number 2 Region: 526-586
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000132
Family Cadherin 0.031
Further Details:      
 
Weak hits

Sequence:  gi|256389646|ref|YP_003111210.1|
Domain Number - Region: 406-498
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0133
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256389646|ref|YP_003111210.1|
Sequence length 592
Comment Ig family protein [Catenulispora acidiphila DSM 44928]
Sequence
MRRILLAGVITSALSTVAAMAMVQPAEAAVSPQIVPASCASAPAGHAHCNAVQLVPSGAR
PAAPTGFGPSDIQSAYNLGTNPGSGQTVAIVDAYDDPNAESDLRTYRSQWGLSACTTANG
CFSKVDQNGGTTYPSGDSGWGAEITLDLDAVSAACPGCHILLVEATTNDDNDLGAAVDEA
VRLGAKFVSNSYSDAESDFTTGMDAHYNHPGVMIAAATGDNGTQSGSSAQFPATFPSVVA
VGGTSLSQASNSRGWSESVWNKGGSGCSSLFAKPSYQQNVTTNCAKRASADVSADANPNT
GLAIYDSYGQSGWEEYGGTSLATPLISAMWAQAGAPASGDSGVSYLYANEAKFNDVTSGS
NGSCGTVICNAGTGWDGPTGVGTPNGVSGFASGTTPPPPANDFSVSVSPASGSVNPGSSA
TSTVGTKVASGSAVTVQLSASGLPSGASASFNPASVTAGSSSTMTIATSASTPAGTYSVT
VTGTAGSTTHTAAYSLTVNGTGGGGTVTVSNPGTQLWFVGYQSQPLQIRASDSKNLALTF
SATGLPPGLGISASGVISGTPTRAGTYQVTVKATDSGGGSGSTTFGYQVYGF
Download sequence
Identical sequences C7PVL3
gi|256389646|ref|YP_003111210.1| WP_012784664.1.73754 479433.Caci_0417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]