SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389661|ref|YP_003111225.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389661|ref|YP_003111225.1|
Domain Number 1 Region: 57-158
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.6e-27
Family Cellulose-binding domain family II 0.00045
Further Details:      
 
Domain Number 2 Region: 163-251
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-16
Family Fibronectin type III 0.0000943
Further Details:      
 
Domain Number 3 Region: 297-534
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000000104
Family Type II chitinase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256389661|ref|YP_003111225.1|
Sequence length 562
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MLRALRASLIAAGAGALLVSGLTIASPTASAATTPTPTATAPTTPTATAPTTPTPLPTAV
YSKTSDWGSGFQAQYVITNPMSVPLNTWSLQFSLPSTEKITSMWGGTDTASGTTHTVLAQ
SYDTTIAAGASITIGFDGSYSGTYADPSACKLNSDPCDGSADAQAPTAPTALTTLSTTSS
AASLSWTGSADNVTVAGYNVYSGSTMVATSPGTAATVTGLAPSTSYSFTVRAVDEAGNLS
APSAAVSATTLASTGGGHLPGVAAPFVDIGAWPTPNLTQIAETTGLRQFSLGFIVNGTAT
CTPSWFNAYAMSAGFEQSDIATLRAIGGDVKPSFGGEAGTELAQSCTDVPSLTAAYQSAI
TAYNLTQIDFDIEGSAVADPASIDRRSQAIAALQKNAAAAGKPLTVTLTLPILPSGLTTD
GLYVVQSAVKYGAKITTVNGMAMDFGDIEAPNPSGKMGTYAIDTAQSLHTQLTPLYPALT
ATQLWNMIGVTPMIGQNDNSSEVFYQTDMHQLLTFAQQQHLGELAFWDVTRDANACTGSL
SKCTDIPQTPYEFSKMIAPYQG
Download sequence
Identical sequences C7PVM8
479433.Caci_0432 WP_012784679.1.73754 gi|256389661|ref|YP_003111225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]